The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of methylglyoxal synthase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1wo8 Target Id ttk003000488.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14381, Molecular Weight 13379.00 Da.
    Residues 126 Isoelectric Point 8.69
    Sequence mkalaliahdakkdemvafclrhkdvlarypllatgttgariqeatglavervlsgplggdlqigarva egkvlavvflqdpltakphepdvqalmrvcnvhgvplatnlvaaealiawirkgtpq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.70 Rfree 0.204
    Matthews' coefficent 3.00 Rfactor 0.185
    Waters 816 Solvent Content 58.20

    Ligand Information
    Ligands SO4 (SULFATE) x 7



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch