.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wq5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Conformational Changes in the alpha-Subunit Coupled to Binding of the beta(2)-Subunit of Tryptophan Synthase from Escherichia coli: Crystal Structure of the Tryptophan Synthase alpha-Subunit Alon. Biochemistry 44 1184-1192 2005
    Site RSGI
    PDB Id 1wq5 Target Id my_001000019.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS13682, Molecular Weight 28722.48 Da.
    Residues 268 Isoelectric Point 5.31
    Sequence meryeslfaqlkerkegafvpfvtlgdpgieqslkiidtlieagadalelgipfsdpladgptiqnatl rafaagvtpaqcfemlalirqkhptipigllmyanlvfnkgidefyaqcekvgvdsvlvadvpveesap frqaalrhnvapificppnadddllrqiasygrgytyllsragvtgaenraalplnhlvaklkeynaap plqgfgisapdqvkaaidagaagaisgsaivkiieqhinepekmlaalkvfvqpmkaatrs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.248
    Matthews' coefficent 2.17 Rfactor 0.185
    Waters 197 Solvent Content 43.30

    Ligand Information
    Ligands SO4 (SULFATE) x 13;GOL (GLYCEROL) x 8
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch