The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structures of Biotin Protein Ligase from Pyrococcus horikoshii OT3 and its Complexes: Structural Basis of Biotin Activation. J.Mol.Biol. 353 322-333 2005
    Site RSGI
    PDB Id 1wqw Target Id pho001000147.8
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13789, Molecular Weight 26070.16 Da.
    Residues 235 Isoelectric Point 8.96
    Sequence mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespegglwlsivlspk vpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegkgdkivlgiglnvnnkvpn gatsmklelgsevpllsvfrslitnldrlylnflknpmdilnlvrdnmilgvrvkilgdgsfegiaedi ddfgrliirldsgevkkviygdvslrfl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.45 Rfree 0.24
    Matthews' coefficent 2.14 Rfactor 0.212
    Waters 1031 Solvent Content 42.50

    Ligand Information
    Ligands BT5 (BIOTINYL-5-AMP) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch