The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural characterization of the MIT domain from human Vps4b. Biochem.Biophys.Res.Commun. 334 460-465 2005
    Site RSGI
    PDB Id 1wr0 Target Id ar_001000797.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12218, Molecular Weight 9191.83 Da.
    Residues 81 Isoelectric Point 7.02
    Sequence gsdhmsstspnlqkaidlaskaaqedkagnyeealqlyqhavqyflhvvkyeaqgdkakqsirakctey ldraeklkeylk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch