.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wr2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of PH1788 from Pyrococcus horikoshii Ot3. To be Published
    Site RSGI
    PDB Id 1wr2 Target Id pho001001788.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14005, Molecular Weight 26835.20 Da.
    Residues 238 Isoelectric Point 5.38
    Sequence mkeeavrvieevlkqgrtamveyeakqvlkayglpvpeeklaktldealeyakeigypvvlklmspqil hksdakvvmlnikneeelkkkweeihenakkyrpdaeilgvlvapmlkpgreviigvtedpqfghaimf glggifveilkdvtfrlvpitekdarkmiqeikaypilagargeepadidaivdmllkvsklvddlkdy ikemdlnpvfvynkgegavivdsriilkpkd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.252
    Matthews' coefficent 2.50 Rfactor 0.228
    Waters 175 Solvent Content 50.80

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch