The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a haloacid dehalogenase superfamily phosphatase PH1421 from Pyrococcus horikoshii OT3: oligomeric state and thermoadaptation mechanism. Acta Crystallogr.,Sect.D 64 1068-1077 2008
    Site RSGI
    PDB Id 1wr8 Target Id pho001001421.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13992, Molecular Weight 25604.25 Da.
    Residues 231 Isoelectric Point 6.93
    Sequence mkikaisididgtitypnrmihekaleairraeslgipimlvtgntvqfaeaasiligtsgpvvaedgg aisykkkriflasmdeewilwneirkrfpnartsytmpdrraglvimretinvetvreiinelnlnlva vdsgfaihvkkpwinkgsgiekaseflgikpkevahvgdgendldafkvvgykvavaqapkilkenady vtkkeygeggaeaiyhilekfgyl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.2117
    Matthews' coefficent 2.20 Rfactor 0.1973
    Waters 568 Solvent Content 43.20

    Ligand Information
    Ligands ACT (ACETATE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch