.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wrv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of T.th.HB8 Branched-Chain Amino Acid Aminotransferase. TO BE PUBLISHED
    Site RSGI
    PDB Id 1wrv Target Id ttk003000081.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14215, Molecular Weight 34032.25 Da.
    Residues 308 Isoelectric Point 5.95
    Sequence mqikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfynsakvlrm eipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmvaawewgaylgeeavrkg arlitsswarfpanvmpgkakvggnyvnsalakmeavaagadeallldeegyvaegsgenlffvrdgvi yalehsvnlegitrdsviriakdlgyevqvvratrdqlymadevfmtgtaaevtpvsmidwrpigkgta gpvalrlrevyleavtgrrpeyegwltyvngq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.50 Rfree 0.218
    Matthews' coefficent 2.92 Rfactor 0.205
    Waters 312 Solvent Content 57.94

    Ligand Information
    Ligands PLP (PYRIDOXAL-5'-PHOSPHATE) x 3;MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 5
    Metals CL (CHLORIDE) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch