.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ws6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of thermus thermphillus HB8 hypothetical protein TTHA0928. TO BE PUBLISHED
    Site RSGI
    PDB Id 1ws6 Target Id ttk003001253.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14667, Molecular Weight 20050.45 Da.
    Residues 185 Isoelectric Point 9.88
    Sequence mgfakppwggklkgvvrilggkargvalkvpasarpspvrlrkalfdylrlryprrgrfldlfagsgav gleaasegweavlvekdpeavrllkenvrrtglgarvvalpvevflpeakaqgerftvafmappyamdl aalfgellasglveagglyvlqhpkdlylplgerrvygenaltlvev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.283
    Matthews' coefficent 2.71 Rfactor 0.218
    Waters 92 Solvent Content 54.57

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch