.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wu2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of molybdopterin biosynthesis moeA protein from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 1wu2 Target Id pho001001647.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14001, Molecular Weight 44045.79 Da.
    Residues 396 Isoelectric Point 5.43
    Sequence mmefkklvpyrealklllddineiedtekvplreavgrvlaedivtefdippfdraavdgyairaedtf qareynpieltvieevpagnvakeevttgkaikvltgtripkganavimqemvkregdkiyvlrpvapg qniaftgedvkkgevvlrkgtilrpqdvamlkalgikkvpvkvkpkvgiiitgselieepseegfkegk ivetnsimlqglvekffgepilygvlpddesiiketlekaknecdivlitggsafgdkdyahkfvnllf hgttikpgrpfgygekvfimsgypvsvfaqfnlfvkhalakmvgaqnyevkvkailqddipsqlgryef ikiyyengiarvikkkgsgilssllasnayleipedsegyrrgeevwitly
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.28226
    Matthews' coefficent 2.50 Rfactor 0.23321
    Waters 423 Solvent Content 50.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch