.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wuq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Novel reaction mechanism of GTP cyclohydrolase I. High-resolution X-ray crystallography of Thermus thermophilus HB8 enzyme complexed with a transition state analogue, the 8-oxoguanine derivative. J.Biochem.(Tokyo) 138 263-275 2005
    Site RSGI
    PDB Id 1wuq Target Id ttk003000188.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14266, Molecular Weight 24538.13 Da.
    Residues 220 Isoelectric Point 5.76
    Sequence mspgpqsggqergsmerkmveledtgltfatevdlerlqalaaewlqvigedpgregllktpervakaw afltrgyrqrleevvggavfpaegsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfari vdmfarrlqvqerlavqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqkt reeflshlrdgta
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 2.00 Rfree 0.237
    Matthews' coefficent 2.47 Rfactor 0.207
    Waters 277 Solvent Content 50.20

    Ligand Information
    Ligands 8GT (8-OXO-GUANOSINE-5'-TRIPHOSPHATE) x 5
    Metals ZN (ZINC) x 5

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch