.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wv8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the hypothetical protein TTHA1013 from Thermus thermophilus HB8. Proteins 61 1117-1120 2005
    Site RSGI
    PDB Id 1wv8 Target Id ttk003001413.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14719, Molecular Weight 7914.70 Da.
    Residues 73 Isoelectric Point 4.13
    Sequence mrtlkvqalwdgeagvwvaesddvpglateaatleellaklavmvpelleengvalelpvelrleatrp lvfs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.273
    Matthews' coefficent 2.88 Rfactor 0.259
    Waters 38 Solvent Content 56.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch