.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wv9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the single-domain rhodanese homologue TTHA0613 from Thermus thermophilus HB8. Proteins 64 284-287 2006
    Site RSGI
    PDB Id 1wv9 Target Id ttk003001651.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14763, Molecular Weight 10372.56 Da.
    Residues 94 Isoelectric Point 5.43
    Sequence mrkvrpeelpalleegvlvvdvrpadrrstplpfaaewvplekiqkgehglprrplllvcekgllsqva alyleaegyeamslegglqaltqgk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.258
    Matthews' coefficent 2.27 Rfactor 0.215
    Waters 132 Solvent Content 44.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch