The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the tRNA 3' Processing Endoribonuclease tRNase Z from Thermotoga maritima. J.Biol.Chem. 280 14138-14144 2005
    Site RSGI
    PDB Id 1ww1 Target Id ar_001000499.1
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS12167, Molecular Weight 32655.90 Da.
    Residues 280 Isoelectric Point 9.12
    Sequence mniigfskalfstwiyysperilfdagegvsttlgskvyafkyvflthghvdhiaglwgvvnirnngmg drekpldvfypegnraveeytefikranpdlrfsfnvhplkegervflrnaggfkryvqpfrtkhvsse vsfgyhifevrrklkkefqgldskeisrlvkekgrdfvteeyhkkvltisgdslaldpeeirgtellih ectfldardrryknhaaidevmesvkaagvkkvilyhistryirqlksvikkyreempdveilymdprk vfem
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.279
    Matthews' coefficent 3.00 Rfactor 0.225
    Waters 49 Solvent Content 58.00

    Ligand Information
    Metals ZN (ZINC) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch