.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wwk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of phosphoglycerate dehydrogenase from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 1wwk Target Id pho001001387.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13991, Molecular Weight 33652.54 Da.
    Residues 307 Isoelectric Point 6.58
    Sequence mkrmkvlvaaplhekaiqvlkdagleviyeeypdedrlvelvkdveaiivrskpkvtrrviesapklkv iaragvgldnidveaakekgievvnapaassrsvaelavglmfsvarkiafadrkmregvwakkeamgi elegktigiigfgrigyqvakianalgmnillydpypneerakevngkfvdletllkesdvvtihvplv estyhlineerlklmkktailintsrgpvvdtnalvkalkegwiagagldvfeeeplpkdhpltkfdnv vltphigastveaqeragvevaekvvkilkg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.246
    Matthews' coefficent 2.60 Rfactor 0.224
    Waters 546 Solvent Content 51.40

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch