The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ttk003001694 from Thermus Thermophilus HB8. TO BE PUBLISHED
    Site RSGI
    PDB Id 1wwp Target Id ttk003001694.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14779, Molecular Weight 13705.04 Da.
    Residues 119 Isoelectric Point 6.62
    Sequence maekalatlkelafledpspverdaaiqrfeytfeafwkalqaylrekeglegaspkgvirlarevgll rdeearlalgmvddrsltvhtyneplaraifrrlpdyarlmeqvlgrlrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.11 Rfree 0.27
    Matthews' coefficent 2.20 Rfactor 0.217
    Waters 58 Solvent Content 43.00

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch