.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wws

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ttk003001566 from Thermus Thermophilus HB8. to be published
    Site RSGI
    PDB Id 1wws Target Id ttk003001566.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14742, Molecular Weight 16858.60 Da.
    Residues 148 Isoelectric Point 5.14
    Sequence mlmkvaeferlfrqaagldvdkndlkrvsdflrnklydllavaernakyngrdlifepdlpiakglqet lqefrrmdtalelkpvldalaalppldlevaedvrnllpelagalvvayarvlkeldpalknpqtehhe raervfnlll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 1.90 Rfree 0.254
    Matthews' coefficent 2.30 Rfactor 0.208
    Waters 709 Solvent Content 44.80

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 6

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch