.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wwt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the TGS domain from human threonyl-tRNA synthetase. To be Published
    Site RSGI
    PDB Id 1wwt Target Id hss001001576.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13268, Molecular Weight 8365.92 Da.
    Residues 75 Isoelectric Point 4.20
    Sequence dskpikvtlpdgkqvdaeswkttpyqiacgisqgladntviakvnnvvwdldrpleedctlellkfede eaqavy
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch