The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the C-terminal DUF1000 domain of the human thioredoxin-like 1 protein. Proteins 78 2176-2180 2010
    Site RSGI
    PDB Id 1wwy Target Id hss001003443.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13325, Molecular Weight 18075.34 Da.
    Residues 158 Isoelectric Point 4.38
    Sequence gymdlmpfinkagceclnesdehgfdnclrkdttflesdcdeqllitvafnqpvklysmkfqgpdngqg pkyvkifinlprsmdfeeaerseptqalelteddikedgivplryvkfqnvnsvtifvqsnqgeeettr isyftfigtpvqatnmndfk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch