.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wwz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of PH1933 from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 1wwz Target Id pho001001933.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14023, Molecular Weight 18462.67 Da.
    Residues 159 Isoelectric Point 9.17
    Sequence mdeikieklkkldkkalnelidvymsgyegleeyggegrdyarnyikwcwkkasdgffvakvgdkivgf ivcdkdwfskyegrivgaihefvvdkkfqgkgigrkllitcldflgkyndtielwvgeknygamnlyek fgfkkvgksgiwvrmikrqnl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.75 Rfree 0.236
    Matthews' coefficent 2.50 Rfactor 0.212
    Waters 374 Solvent Content 50.81

    Ligand Information
    Ligands ACO (ACETYL) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch