.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wx1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of nictinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1wx1 Target Id ttk003000214.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14274, Molecular Weight 34745.33 Da.
    Residues 335 Isoelectric Point 6.47
    Sequence mdpevfaqarlrmdqltkppralgyleevalrlaalqgrvkpelgrgavvvaaadhgvvaegvsaypqe vtrqmvlnflrggaainqfalaadcavyvldvgvvgelpdhpgllkrkvrpgtanlaqgpamtpeeaer allagreaarraiaegatllaagdmgignttaaaaltaallglppeavvgrgtgvgeeglrrkrqavar alarlhpgmgplevaaevgglelvaiagiylegyeaglplvldgfpvtagallawkmapglrdhlfagh lsrepghrhqlealglrplldldlalgegtgavlampllraaarilhmatfqeagvsrg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.97 Rfree 0.219
    Matthews' coefficent 2.53 Rfactor 0.185
    Waters 449 Solvent Content 51.44

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch