.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wx6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SH3 domain of the human cytoplasmic protein NCK2. To be Published
    Site RSGI
    PDB Id 1wx6 Target Id hsi002004659.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12373, Molecular Weight 8730.43 Da.
    Residues 78 Isoelectric Point 5.22
    Sequence lsngqgsrvlhvvqtlypfssvteeelnfekgetmeviekpendpewwkcknargqvglvpknyvvvls dgpalhpah
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch