The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of GTP binding protein from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 1wxq Target Id pho001000525.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13831, Molecular Weight 44406.70 Da.
    Residues 397 Isoelectric Point 6.19
    Sequence meigvvgkpnvgkstffsaatlvdveianypfttieanvgvtyaitdhpckelgcspnpqnyeyrngla lipvkmvdvaglvpgahegrglgnkflddlrmasalihvvdatgktdpegqptdyhdpvedieflerei dywiygilskgwdkfakriklqkiklesaiaehlsgigvnendvweamhklnlpedptkwsqddllafa seirrvnkpmviaankadaasdeqikrlvreeekrgyiviptsaaaeltlrkaakagfieyipgasefk vlrdmsekqkralmvikekvldrfgstgvqevinrvvfdllklipvypvhdenkltdqfgnvlphvflm kkgstprdlafkvhtdlgkgflyainartkrrvgedyelqfndivkivsvtr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.29165
    Matthews' coefficent 2.40 Rfactor 0.2659
    Waters 89 Solvent Content 47.90

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch