.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wxt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SH3 domain of human hypothetical protein FLJ21522. To be Published
    Site RSGI
    PDB Id 1wxt Target Id hss001001086.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13235, Molecular Weight 6481.17 Da.
    Residues 55 Isoelectric Point 6.79
    Sequence lkmqvlyefearnpreltvvqgeklevldhskrwwlvkneagrsgyipsnilepl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch