.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wxw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of a putative RNA 5-methyluridine methyltransferase, Thermus thermophilus TTHA1280, and its complex with S-adenosyl-L-homocysteine. Acta Crystallogr.,Sect.F 61 867-874 2005
    Site RSGI
    PDB Id 1wxw Target Id ttk003001595.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14752, Molecular Weight 42945.04 Da.
    Residues 382 Isoelectric Point 9.01
    Sequence mriqvnakgaarllsrhlwvfrrdvvsgpetpglypvywgrrflalalynphtdlavrayrfapaedpv aallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdxyaghavvqatahawegllpqvaealr phvqsvlakndartreleglplyvrpllgevpervqvqegrvrylvdlragqktgayldqrenrlymer frgeraldvfsyaggfalhlalgfrevvavdssaealrraeenarlnglgnvrvleanafdllrrleke gerfdlvvldppafakgkkdverayraykevnlraikllkeggilatascshhmteplfyamvaeaaqd ahrllrvvekrgqpfdhpvllnhpethylkfavfqvl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.55 Rfree 0.279
    Matthews' coefficent 2.35 Rfactor 0.223
    Waters 38 Solvent Content 47.20

    Ligand Information
    Ligands HEZ (HEXANE-1,6-DIOL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch