.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wxx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of a putative RNA 5-methyluridine methyltransferase, Thermus thermophilus TTHA1280, and its complex with S-adenosyl-L-homocysteine. Acta Crystallogr.,Sect.F 61 867-874 2005
    Site RSGI
    PDB Id 1wxx Target Id ttk003001595.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14753, Molecular Weight 42998.07 Da.
    Residues 382 Isoelectric Point 8.99
    Sequence mriqvnakgaarllsrhlwvfrrdvvsgpetpglypvywgrrflalalynphtdlavrayrfapaedpv aallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvqatahawegllpqvaealr phvqsvlakndartreleglplyvrpllgevpervqvqegrvrylvdlragqktgayldqrenrlymer frgeraldvfsyaggfalhlalgfrevvavdssaealrraeenarlnglgnvrvleanafdllrrleke gerfdlvvldppafakgkkdverayraykevnlraikllkeggilatascshhmteplfyamvaeaaqd ahrllrvvekrgqpfdhpvllnhpethylkfavfqvl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.229
    Matthews' coefficent 2.88 Rfactor 0.203
    Waters 1105 Solvent Content 56.90

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 8
    Metals K (POTASSIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch