The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Prolidase from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 1wy2 Target Id pho001001149.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13976, Molecular Weight 39398.40 Da.
    Residues 351 Isoelectric Point 5.48
    Sequence mdimnekvkkiiefmdknsidavliaknpnvyyisgasplaggyilitgesatlyvpeleyemakeesn ipvekfkkmdefykalegikslgiesslpygfieelkkkanikefkkvddvirdmriiksekeikiiek aceiadkavmaaieeitegkkerevaakveylmkmngaekpafdtiiasgyrsalphgvasdkriergd lvvidlgalyqhynsditrtivvgspnekqkeiyeivleaqkkavesakpgitakeldsiarniiaeyg ygeyfnhslghgvglevhewprvsqydetvlregmvitiepgiyipkiggvriedtilitkngskrltk tereli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.21
    Matthews' coefficent 2.38 Rfactor 0.187
    Waters 682 Solvent Content 48.32

    Ligand Information
    Ligands CAC (CACODYLATE) x 2;GOL (GLYCEROL) x 2
    Metals ZN (ZINC) x 4;MG (MAGNESIUM) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch