.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wy5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for lysidine formation by ATP pyrophosphatase accompanied by a lysine-specific loop and a tRNA-recognition domain. Proc.Natl.Acad.Sci.Usa 102 7487-7492 2005
    Site RSGI
    PDB Id 1wy5 Target Id ar_001000718.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12212, Molecular Weight 37318.53 Da.
    Residues 317 Isoelectric Point 9.17
    Sequence mnpesrvirkvlalqndekifsgerrvliafsggvdsvvltdvllklknyfslkevalahfnhmlresa erdeefckefakernmkifvgkedvrafakenrmsleeagrflrykflkeilesegfdciatahhlndl letsllfftrgtgldgligflpkeevirrplyyvkrseieeyakfkglrwvedetnyevsiprnrirhr vipelkrinenledtflkmvkvlraerefleeeaqklykevkkgncldvkklkekplalqrrvirkfig ekdyekvelvrsllekggevnlgkgkvlkrkerwlcfspev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.42 Rfree 0.253
    Matthews' coefficent 3.40 Rfactor 0.218
    Waters 77 Solvent Content 63.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch