.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wy8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the N-terminal Ubiquitin-like Domain in Human Np95/ICBP90-like Ring Finger Protein (NIRF). To be Published
    Site RSGI
    PDB Id 1wy8 Target Id hsi002011909.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12462, Molecular Weight 9036.88 Da.
    Residues 76 Isoelectric Point 5.07
    Sequence mwiqvrtidgsktctiedvsrkatieelrervwalfdvrpecqrlfyrgkqlengytlfdydvglndii qllvrpd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch