.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wyu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of P-protein of the glycine cleavage system: implications for nonketotic hyperglycinemia. Embo J. 24 1523-1536 2005
    Site RSGI
    PDB Id 1wyu Target Id ttk003000355.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14343, Molecular Weight 52705.99 Da.
    Residues 474 Isoelectric Point 7.79
    Sequence msfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrrqvgvdttfy plgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkaltgmdaitlepaagahgelt giliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqvreipsgpegevdlealkrelgphvaal mltnpntlglferrileisrlckeagvqlyydganlnaimgwarpgdmgfdvvhlnlhktftvphgggg pgsgpvgvkahlapylpvplvergeegfyldfdrpksigrvrsfygnflalvrawayirtlgleglkka aalavlnarylkellkekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkeal mvepteteaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfdeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.229
    Matthews' coefficent 2.69 Rfactor 0.189
    Waters 2145 Solvent Content 54.00

    Ligand Information
    Ligands PLP (PYRIDOXAL-5'-PHOSPHATE) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch