The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the HMG_box Domain of Murine Bobby Sox Homolog. To be Published
    Site RSGI
    PDB Id 1wz6 Target Id mmt008001260.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13650, Molecular Weight 8279.21 Da.
    Residues 69 Isoelectric Point 10.08
    Sequence arrpmnafllfckrhrslvrqehprldnrgatkiladwwavldpkekqkytdmakeykdafmkanpgyr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch