.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wz7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an enhancer of rudimentary homolog (ERH) at 2.1 Angstroms resolution. Protein Sci. 14 1888-1893 2005
    Site RSGI
    PDB Id 1wz7 Target Id mmt005001294.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13465, Molecular Weight 12258.32 Da.
    Residues 104 Isoelectric Point 5.63
    Sequence mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlfdfiddladlsc lvyradtqtyqpynkdwikekiyvllrrqaqqagk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.272
    Matthews' coefficent 2.17 Rfactor 0.219
    Waters 79 Solvent Content 43.36

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch