.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x01

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate. J.Biol.Chem. 283 14739-14750 2008
    Site RSGI
    PDB Id 1x01 Target Id pho001000147.9
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13790, Molecular Weight 26070.16 Da.
    Residues 235 Isoelectric Point 8.96
    Sequence mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespegglwlsivlspk vpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegkgdkivlgiglnvnnkvpn gatsmklelgsevpllsvfrslitnldrlylnflknpmdilnlvrdnmilgvrvkilgdgsfegiaedi ddfgrliirldsgevkkviygdvslrfl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.225
    Matthews' coefficent 2.14 Rfactor 0.195
    Waters 337 Solvent Content 42.50

    Ligand Information
    Ligands ATP (ADENOSINE-5'-TRIPHOSPHATE) x 2;PO4 (PHOSPHATE) x 1;ACY (ACETIC) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch