.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x0j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for acetylated histone H4 recognition by the human Brd2 bromodomain. To be Published
    Site RSGI
    PDB Id 1x0j Target Id ar_001000221.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12127, Molecular Weight 13623.90 Da.
    Residues 122 Isoelectric Point 7.08
    Sequence krrlennyywaasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpqeeqelvvtipkns hkkgaklaalqgsvtsahqvpavssvshtalytpppeipttvfniphpsviss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.21273
    Matthews' coefficent 2.30 Rfactor 0.17785
    Waters 352 Solvent Content 47.00

    Ligand Information
    Ligands DTT (2,3-DIHYDROXY-1,4-DITHIOBUTANE) x 3;MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch