.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x1l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Interaction of Era with the 30S Ribosomal Subunit Implications for 30S Subunit Assembly. Mol.Cell 18 319-329 2005
    Site RSGI
    PDB Id 1x1l Target Id ttk003001341.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14690, Molecular Weight 33807.44 Da.
    Residues 301 Isoelectric Point 5.98
    Sequence maektysgfvaivgkpnvgkstllnnllgvkvapisprpqttrkrlrgiltegrrqivfvdtpglhkpm dalgefmdqevyealadvnavvwvvdlrhpptpedelvaralkplvgkvpillvgnkldaakypeeamk ayhellpeaeprmlsalderqvaelkadllalmpegpffypedyaksdqtfgewvaeilreeamkrlwh evpyavatkveevaerengvlyikailyverpsqkaivigeggrkikeigqatrkqleallgkkvyldl evkvypdwrkdpealrelgyrssvg
      BLAST   FFAS

    Structure Determination
    Method Chains 1
    Resolution (Å) 13.50 Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch