.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x1o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of project ID TT0268 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1x1o Target Id ttk003000268.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14316, Molecular Weight 30421.28 Da.
    Residues 286 Isoelectric Point 5.95
    Sequence mggvvgealwqggleealrawlredlgqgdltsllvvpedlegeavilakeggvlaglwvaervfalad prtaftplvaegarvaegtevarvrgplrgilagerlalnllqrlsgiatltrayvealagtkaqildt rkttpglralekyavrvgggrnhryglfdgillkenhvraaggvgeavrrakaraphylkvevevrsle eleealeagadlilldnfplealreavrrvggrvpleasgnmtlerakaaaeagvdyvsvgalthsaka ldlsllvvrp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.90 Rfree 0.246
    Matthews' coefficent 2.50 Rfactor 0.221
    Waters 773 Solvent Content 49.90

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch