The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for defects of keap1 activity provoked by its point mutations in lung cancer. Mol.Cell 21 689-700 2006
    Site RSGI
    PDB Id 1x2j Target Id ar_001000355.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS12148, Molecular Weight 33857.26 Da.
    Residues 309 Isoelectric Point 6.14
    Sequence qavpcrapkvgrliytaggyfrqslsyleaynpsngswlrladlqvprsglagcvvggllyavggrnns pdgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiyavggshgcihhssveryeperdewhl vapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitpmntirsgagvcvlhnciya aggydgqdqlnsverydvetetwtfvapmrhrsalgitvhqgkiyvlggydghtfldsvecydpdsdtw sevtrmtsgrsgvgvavtmepcrkqidqqnctc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.2
    Matthews' coefficent 2.40 Rfactor 0.168
    Waters 346 Solvent Content 49.00

    Ligand Information
    Ligands SO4 (SULFATE) x 8



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch