.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x2m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the homeobox domain of mouse LAG1 longevity assurance homolog 6. To be Published
    Site RSGI
    PDB Id 1x2m Target Id mmt008000773.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13633, Molecular Weight 6159.72 Da.
    Residues 51 Isoelectric Point 10.15
    Sequence taqpnailekvftaitkhpdekrleglskqldwdvrsiqrwfrqrrnqekp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch