.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x2r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for defects of keap1 activity provoked by its point mutations in lung cancer. Mol.Cell 21 689-700 2006
    Site RSGI
    PDB Id 1x2r Target Id ar_001000355.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS12149, Molecular Weight 33857.26 Da.
    Residues 309 Isoelectric Point 6.14
    Sequence qavpcrapkvgrliytaggyfrqslsyleaynpsngswlrladlqvprsglagcvvggllyavggrnns pdgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiyavggshgcihhssveryeperdewhl vapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitpmntirsgagvcvlhnciya aggydgqdqlnsverydvetetwtfvapmrhrsalgitvhqgkiyvlggydghtfldsvecydpdsdtw sevtrmtsgrsgvgvavtmepcrkqidqqnctc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.214
    Matthews' coefficent 2.40 Rfactor 0.191
    Waters 424 Solvent Content 49.00

    Ligand Information
    Ligands LEU-ASP-GLU-GLU-THR-GLY-GLU-PHE-LEU (SULFATE) x 1;SO4 x 9
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch