The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the PH0495 protein from pyrococccus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 1x3l Target Id pho001000495.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13824, Molecular Weight 47372.03 Da.
    Residues 440 Isoelectric Point 5.57
    Sequence miamdireiglrlvgeaikaadpyravlnavkvsddkiivqgkefeikgkvyvialgkaacemaraied ildvedgvavtkygygkelkrikvieaghpipdeksilgakealsilnrarendivfilisgggsalfe lpeegisledlklttdlllksgakiheintvrkhiskvkggklakmikgtgivliisdvvgdnleaias gptvkdpttfedakrilelydiwekvpesvrlhierglrgeveetlkedlpnvhnfliasnsisceaia reaqrlgfkayimtttlegeakdaglfigsivqeiaergrpfeppvvlvfggettvtiegkggkggpnq eialsatrkisdlealivafdtdgtdgptdaaggivdgttykklrekgidvekvlkehnsyealkkvgg llftgptgtnvnsiviaivtskrgrt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.231
    Matthews' coefficent 2.81 Rfactor 0.199
    Waters 249 Solvent Content 56.23

    Ligand Information
    Ligands SO4 (SULFATE) x 1;EDO (1,2-ETHANEDIOL) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch