.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x3o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the acyl carrier protein from thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1x3o Target Id ttk003000144.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14249, Molecular Weight 9013.77 Da.
    Residues 80 Isoelectric Point 4.26
    Sequence mteqeifekvkaviadklqvepekvtlearfiedlgadsldtvelimgledefgleisdeeaekirtvk daveyikaklg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.282
    Matthews' coefficent 3.15 Rfactor 0.252
    Waters 100 Solvent Content 60.94

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch