The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the probable haloacid dehalogenase PH0459 from Pyrococcus horikoshii OT3. Protein Sci. 15 373-377 2006
    Site RSGI
    PDB Id 1x42 Target Id pho001000459.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13821, Molecular Weight 26724.32 Da.
    Residues 232 Isoelectric Point 5.30
    Sequence miravffdfvgtllsvegeakthlkimeevlgdyplnpktlldeyekltreafsnyagkpyrpirdiee evmrklaekygfkypenfweihlrmhqrygelypevvevlkslkgkyhvgmitdsdteylmahldalgi kdlfdsittseeagffkphprifelalkkagvkgeeavyvgdnpvkdcggsknlgmtsilldrkgekre fwdkcdfivsdlrevikivdelngq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.207
    Matthews' coefficent 2.43 Rfactor 0.166
    Waters 150 Solvent Content 49.46

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch