.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x45

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the first PDZ domain of amyloid beta A4 precursor protein-binding family A, member 1. to be published
    Site RSGI
    PDB Id 1x45 Target Id hso001000025.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12899, Molecular Weight 8985.15 Da.
    Residues 85 Isoelectric Point 8.95
    Sequence dvfiekqkgeilgvvivesgwgsilptviianmmhggpaeksgklnigdqimsingtslvglplstcqs iikglknqsrvklniv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch