The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of DSRM domain in DGCR8 protein. To be Published
    Site RSGI
    PDB Id 1x47 Target Id hss001001406.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13252, Molecular Weight 9410.25 Da.
    Residues 85 Isoelectric Point 6.88
    Sequence efvinpngksevcilheymqrvlkvrpvynffecenpsepfgasvtidgvtygsgtasskklaknkaar atleilipdfvkqtse
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch