.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x49

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the first DSRM domain in Interferon-induced, double-stranded RNA-activated protein kinase. To be Published
    Site RSGI
    PDB Id 1x49 Target Id mmt008000608.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13629, Molecular Weight 9572.30 Da.
    Residues 84 Isoelectric Point 6.82
    Sequence masdtpgfymdklnkyrqmhgvaitykelstsgpphdrrftfqvlidekefpeakgrskqearnaaakl avdildnenkvdcht
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch