The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RRM domain in splicing factor SF2. To be Published
    Site RSGI
    PDB Id 1x4a Target Id hss001003882
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13353, Molecular Weight 10752.30 Da.
    Residues 96 Isoelectric Point 5.08
    Sequence msgggvirgpagnndcriyvgnlppdirtkdiedvfykygairdidlknrrggppfafvefedprdaed avygrdgydydgyrlrvefprsgrgtg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch