.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x4e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RRM domain in RNA binding motif, single-stranded interacting protein 2. To be Published
    Site RSGI
    PDB Id 1x4e Target Id hsi002011398.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12452, Molecular Weight 7706.51 Da.
    Residues 72 Isoelectric Point 9.43
    Sequence lyirglqpgttdqdlvklcqpygkivstkaildkttnkckgygfvdfdspsaaqkavtalkasgvqaqm akq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch