.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x4k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of LIM domain in LIM-protein 3. To be Published
    Site RSGI
    PDB Id 1x4k Target Id hsi002014447.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12513, Molecular Weight 6925.71 Da.
    Residues 59 Isoelectric Point 8.76
    Sequence cqeckktimpgtrkmeykgsswhetcfichrcqqpigtksfipkdnqnfcvpcyekqha
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch