The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of PWI domain in U4/U6 small nuclear ribonucleoprotein Prp3(hPrp3). To be Published
    Site RSGI
    PDB Id 1x4q Target Id hss001001509
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13259, Molecular Weight 8901.83 Da.
    Residues 79 Isoelectric Point 8.82
    Sequence malskreldelkpwiektvkrvlgfseptvvtaalncvgkgmdkkkaadhlkpflddstlrfvdklfea veegrssrhs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch