.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x4t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of Isy1 domain in hypothetical protein. To be Published
    Site RSGI
    PDB Id 1x4t Target Id mmt007014313.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13550, Molecular Weight 9213.21 Da.
    Residues 79 Isoelectric Point 9.61
    Sequence kvkerrpflasectelpkaekwrrqiigeiskkvaqiqnaglgefrirdlndeinkllrekghwevrik elggpdygkv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch