.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x4z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the 2nd fibronectin type III domain from mouse biregional cell adhesion molecule-related/down-regulated oncogenes (Cdon) binding protein. To be Published
    Site RSGI
    PDB Id 1x4z Target Id mmt008000800.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13636, Molecular Weight 11812.80 Da.
    Residues 108 Isoelectric Point 9.63
    Sequence sqpdhgrlsppeapdrptistasetsvyvtwiprgnggfpiqsfrveykklkkvgdwilatsaippsrl sveitglekgisykfrvralnmlgesepsapsrpyvvsg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch